Lineage for d4a3sb_ (4a3s B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1184492Fold c.89: Phosphofructokinase [53783] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest
    Domain 2 has parallel sheet of 4 strands, order 2314
  4. 1184493Superfamily c.89.1: Phosphofructokinase [53784] (2 families) (S)
  5. 1184494Family c.89.1.1: Phosphofructokinase [53785] (3 proteins)
  6. 1184523Protein automated matches [190282] (2 species)
    not a true protein
  7. 1184524Species Bacillus subtilis [TaxId:1423] [194825] (1 PDB entry)
  8. 1184526Domain d4a3sb_: 4a3s B: [194826]
    automated match to d6pfka_

Details for d4a3sb_

PDB Entry: 4a3s (more details), 2.3 Å

PDB Description: Crystal structure of PFK from Bacillus subtilis
PDB Compounds: (B:) 6-phosphofructokinase

SCOPe Domain Sequences for d4a3sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a3sb_ c.89.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
mkrigvltsggdspgmnaavravvrkaiyhdvevygiyngyaglisgkieklelgsvgdi
ihrggtklytarcpefktvegrekgianlkklgieglvviggdgsymgakkltehgfpcv
gvpgtidndipgtdftigfdtalntvidaidkirdtatshertyvievmgrhagdialwa
glaggaesilipeadydmheiiarlkrghergkkhsiiivaegvgsgvefgkrieeetnl
etrvsvlghiqrggspsaadrvlasrlgayavelllegkggrcvgiqnnklvdhdiieil
etkhtveqnmyqlskelsi

SCOPe Domain Coordinates for d4a3sb_:

Click to download the PDB-style file with coordinates for d4a3sb_.
(The format of our PDB-style files is described here.)

Timeline for d4a3sb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4a3sa_