Lineage for d1aonj1 (1aon J:2-136,J:410-525)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217889Fold a.129: GroEL equatorial domain-like chaperone equatorial domain [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 217890Superfamily a.129.1: GroEL equatorial domain-like chaperone equatorial domain [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudodyad passing through the ATP-binding site
  5. 217891Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 217892Protein GroEL, E domain [48594] (2 species)
  7. 217893Species Escherichia coli [TaxId:562] [48595] (4 PDB entries)
  8. 217924Domain d1aonj1: 1aon J:2-136,J:410-525 [19482]
    Other proteins in same PDB: d1aona2, d1aona3, d1aonb2, d1aonb3, d1aonc2, d1aonc3, d1aond2, d1aond3, d1aone2, d1aone3, d1aonf2, d1aonf3, d1aong2, d1aong3, d1aonh2, d1aonh3, d1aoni2, d1aoni3, d1aonj2, d1aonj3, d1aonk2, d1aonk3, d1aonl2, d1aonl3, d1aonm2, d1aonm3, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_

Details for d1aonj1

PDB Entry: 1aon (more details), 3 Å

PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7

SCOP Domain Sequences for d1aonj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aonj1 a.129.1.1 (J:2-136,J:410-525) GroEL, E domain {Escherichia coli}
aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtaaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

SCOP Domain Coordinates for d1aonj1:

Click to download the PDB-style file with coordinates for d1aonj1.
(The format of our PDB-style files is described here.)

Timeline for d1aonj1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aona1, d1aona2, d1aona3, d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonk1, d1aonk2, d1aonk3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_