Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein automated matches [190124] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries) |
Domain d4auqa_: 4auq A: [194819] Other proteins in same PDB: d4auqc1, d4auqc2, d4auqf_ automated match to d3a33a_ complexed with zn |
PDB Entry: 4auq (more details), 2.18 Å
SCOPe Domain Sequences for d4auqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4auqa_ d.20.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} alkrihkelndlardppaqcragpvgddmfhwqatimgpndspyqggvffltihfptdyp fkppkvafttriyhpainsngsisldilrsqwspaltiskvllsicsllcdpnpddplvp eiariyktdrekynriarewtqkyam
Timeline for d4auqa_:
View in 3D Domains from other chains: (mouse over for more information) d4auqc1, d4auqc2, d4auqd_, d4auqf_ |