Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187233] (129 PDB entries) |
Domain d2o8ua_: 2o8u A: [194811] automated match to d2viva_ complexed with ben, peg, pg4, so4 |
PDB Entry: 2o8u (more details), 1.7 Å
SCOPe Domain Sequences for d2o8ua_:
Sequence, based on SEQRES records: (download)
>d2o8ua_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk mlcaadpqwktdscqgdaggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw irsht
>d2o8ua_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} iiggefttienqpwfaaiyrrvtyvcggslispcwvisathcfidypkkedyivylgrsr lnsntqgemkfevenlilhkdysadahhndiallkirskegrcaqpsrtiqtialpsmyn dpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttkmlcaadp qwktdscqgdaggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpwirsht
Timeline for d2o8ua_: