Lineage for d4fqia_ (4fqi A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531229Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1531241Species Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId:284218] [190025] (2 PDB entries)
  8. 1531242Domain d4fqia_: 4fqi A: [194787]
    Other proteins in same PDB: d4fqib_, d4fqil1, d4fqil2
    automated match to d3gbma_
    complexed with edo, gol, nag

Details for d4fqia_

PDB Entry: 4fqi (more details), 1.71 Å

PDB Description: crystal structure of fab cr9114 in complex with a h5n1 influenza virus hemagglutinin
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d4fqia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqia_ b.19.1.2 (A:) Hemagglutinin {Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
pksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwg
ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpnd
ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
tigecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d4fqia_:

Click to download the PDB-style file with coordinates for d4fqia_.
(The format of our PDB-style files is described here.)

Timeline for d4fqia_: