Lineage for d4ap8c_ (4ap8 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2945395Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) (S)
  5. 2945409Family d.41.5.0: automated matches [191646] (1 protein)
    not a true family
  6. 2945410Protein automated matches [191185] (7 species)
    not a true protein
  7. 2945421Species Human (Homo sapiens) [TaxId:9606] [194767] (2 PDB entries)
  8. 2945426Domain d4ap8c_: 4ap8 C: [194768]
    automated match to d2wp4b_
    complexed with edo, gol

Details for d4ap8c_

PDB Entry: 4ap8 (more details), 2.78 Å

PDB Description: crystal structure of human molybdopterin synthase catalytic subunit (mocs2b)
PDB Compounds: (C:) Molybdopterin synthase catalytic subunit

SCOPe Domain Sequences for d4ap8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ap8c_ d.41.5.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eveekskdvinftaeklsvdevsqlvisplcgaislfvgttrnnfegkkvisleyeaylp
maenevrkicsdirqkwpvkhiavfhrlglvpvseasiiiavssahraasleavsyaidt
lkakvpiwkkeiye

SCOPe Domain Coordinates for d4ap8c_:

Click to download the PDB-style file with coordinates for d4ap8c_.
(The format of our PDB-style files is described here.)

Timeline for d4ap8c_: