Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (14 species) not a true protein |
Species Vibrio splendidus [TaxId:314291] [194747] (1 PDB entry) |
Domain d2rk9b_: 2rk9 B: [194748] automated match to d3fcda_ |
PDB Entry: 2rk9 (more details), 1.6 Å
SCOPe Domain Sequences for d2rk9b_:
Sequence, based on SEQRES records: (download)
>d2rk9b_ d.32.1.0 (B:) automated matches {Vibrio splendidus [TaxId: 314291]} tlrvvpelycfdinvsqsffvdvlgfevkyerpdeefvyltldgvdvmlegiagksrkwl sgdlefplgsgvnfqwdvidieplyqrvnesaadsiylalesksyqcgdsiatqkqfmvq tpdgylfrfcqdi
>d2rk9b_ d.32.1.0 (B:) automated matches {Vibrio splendidus [TaxId: 314291]} tlrvvpelycfdinvsqsffvdvlgfevkyerpdeefvyltldgvdvmleglefplgsgv nfqwdvidieplyqrvnesaadsiylalesksyqiatqkqfmvqtpdgylfrfcqdi
Timeline for d2rk9b_: