Lineage for d2rk9b_ (2rk9 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200465Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1200466Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1200824Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 1200825Protein automated matches [190239] (6 species)
    not a true protein
  7. 1200845Species Vibrio splendidus [TaxId:314291] [194747] (1 PDB entry)
  8. 1200846Domain d2rk9b_: 2rk9 B: [194748]
    automated match to d3fcda_

Details for d2rk9b_

PDB Entry: 2rk9 (more details), 1.6 Å

PDB Description: the crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase superfamily member from vibrio splendidus 12b01
PDB Compounds: (B:) Glyoxalase/bleomycin resistance protein/dioxygenase

SCOPe Domain Sequences for d2rk9b_:

Sequence, based on SEQRES records: (download)

>d2rk9b_ d.32.1.0 (B:) automated matches {Vibrio splendidus [TaxId: 314291]}
tlrvvpelycfdinvsqsffvdvlgfevkyerpdeefvyltldgvdvmlegiagksrkwl
sgdlefplgsgvnfqwdvidieplyqrvnesaadsiylalesksyqcgdsiatqkqfmvq
tpdgylfrfcqdi

Sequence, based on observed residues (ATOM records): (download)

>d2rk9b_ d.32.1.0 (B:) automated matches {Vibrio splendidus [TaxId: 314291]}
tlrvvpelycfdinvsqsffvdvlgfevkyerpdeefvyltldgvdvmleglefplgsgv
nfqwdvidieplyqrvnesaadsiylalesksyqiatqkqfmvqtpdgylfrfcqdi

SCOPe Domain Coordinates for d2rk9b_:

Click to download the PDB-style file with coordinates for d2rk9b_.
(The format of our PDB-style files is described here.)

Timeline for d2rk9b_: