Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (3 species) not a true protein |
Species Saccharomyces cerevisiae [TaxId:4932] [194506] (3 PDB entries) |
Domain d4gptb_: 4gpt B: [194730] automated match to d1k5db_ complexed with 51k, cl, edo, gnp, gol, mg |
PDB Entry: 4gpt (more details), 2.22 Å
SCOPe Domain Sequences for d4gptb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gptb_ b.55.1.0 (B:) automated matches {Saccharomyces cerevisiae [TaxId: 4932]} taeedeevlykvraklfrfdkdakewkergtgdckflknkktnkvrilmrrdktlkican hiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqei nkk
Timeline for d4gptb_: