SCOPe 2.08: Domain d4gqta_: 4gqt A:

Lineage for d4gqta_ (4gqt A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (13 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [194727] (1 PDB entry)

8. Domain d4gqta_: 4gqt A: [194729]
   automated match to d3bmya_
   complexed with adp, zn

Details for d4gqta_

PDB Entry: 4gqt, 2.15 Å

PDB Description: n-terminal domain of c. elegans hsp90

PDB Compounds: (A:) heat shock protein 90

SCOPe Domain Sequences for d4gqta_:

Sequence; same for both SEQRES and ATOM records:

>d4gqta_ d.122.1.1 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
enaetfafqaeiaqlmsliintfysnkeiylrelisnasdaldkiryqaltepseldtgk
elfikitpnkeektltimdtgigmtkadlvnnlgtiaksgtkafmealqagadismigqf
gvgfysaflvadkvvvtsknndddsyqwessaggsfvvrpfndpevtrgtkivmhikedq
idfleerkikeivkkhsqfigypiklvve

Timeline for d4gqta_:

• d4gqta_ first appeared in SCOPe 2.02
  
• d4gqta_ appears in SCOPe 2.07