Lineage for d4gqta_ (4gqt A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537078Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2537320Protein automated matches [190229] (12 species)
    not a true protein
  7. 2537472Species Nematode (Caenorhabditis elegans) [TaxId:6239] [194727] (1 PDB entry)
  8. 2537473Domain d4gqta_: 4gqt A: [194729]
    automated match to d3bmya_
    complexed with adp, zn

Details for d4gqta_

PDB Entry: 4gqt (more details), 2.15 Å

PDB Description: n-terminal domain of c. elegans hsp90
PDB Compounds: (A:) heat shock protein 90

SCOPe Domain Sequences for d4gqta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gqta_ d.122.1.1 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
enaetfafqaeiaqlmsliintfysnkeiylrelisnasdaldkiryqaltepseldtgk
elfikitpnkeektltimdtgigmtkadlvnnlgtiaksgtkafmealqagadismigqf
gvgfysaflvadkvvvtsknndddsyqwessaggsfvvrpfndpevtrgtkivmhikedq
idfleerkikeivkkhsqfigypiklvve

SCOPe Domain Coordinates for d4gqta_:

Click to download the PDB-style file with coordinates for d4gqta_.
(The format of our PDB-style files is described here.)

Timeline for d4gqta_: