Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins) |
Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species) contains an extra alpha-helical domain |
Species Human coronavirus 229E [TaxId:11137] [89348] (3 PDB entries) |
Domain d3tlob_: 3tlo B: [194725] automated match to d2zu2b_ complexed with gol, peg |
PDB Entry: 3tlo (more details), 1.6 Å
SCOPe Domain Sequences for d3tlob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tlob_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus 229E [TaxId: 11137]} sglkkmaqpsgcvercvvrvcygstvlngvwlgdtvtcprhviapsttvlidydhaystm rlhnfsvshngvflgvvgvtmhgsvlrikvsqsnvhtpkhvfktlkpgdsfnilacyegi asgvfgvnlrtnftikgsfingacgspgynvrndgtvefcylhqielgsgahvgsdftgs vygnfddqpslqvesanlmlsdnvvaflyaallngcrwwlcstrvnvdgfnewamangyt svssvecysilaaktgvsveqllasiqhlhegfggknilgysslcdeftlaevvkqmygv nl
Timeline for d3tlob_: