Lineage for d3tlob_ (3tlo B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1129501Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)
  6. 1129546Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
    contains an extra alpha-helical domain
  7. 1129547Species Human coronavirus 229E [TaxId:11137] [89348] (3 PDB entries)
  8. 1129548Domain d3tlob_: 3tlo B: [194725]
    automated match to d2zu2b_
    complexed with gol, peg

Details for d3tlob_

PDB Entry: 3tlo (more details), 1.6 Å

PDB Description: Crystal structure of HCoV-NL63 3C-like protease
PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d3tlob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tlob_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus 229E [TaxId: 11137]}
sglkkmaqpsgcvercvvrvcygstvlngvwlgdtvtcprhviapsttvlidydhaystm
rlhnfsvshngvflgvvgvtmhgsvlrikvsqsnvhtpkhvfktlkpgdsfnilacyegi
asgvfgvnlrtnftikgsfingacgspgynvrndgtvefcylhqielgsgahvgsdftgs
vygnfddqpslqvesanlmlsdnvvaflyaallngcrwwlcstrvnvdgfnewamangyt
svssvecysilaaktgvsveqllasiqhlhegfggknilgysslcdeftlaevvkqmygv
nl

SCOPe Domain Coordinates for d3tlob_:

Click to download the PDB-style file with coordinates for d3tlob_.
(The format of our PDB-style files is described here.)

Timeline for d3tlob_: