SCOPe 2.08: Domain d3tlob_: 3tlo B:

Lineage for d3tlob_ (3tlo B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
   contains an extra alpha-helical domain

7. Species Human coronavirus [TaxId:443239] [188597] (6 PDB entries)

8. Domain d3tlob_: 3tlo B: [194725]
   automated match to d2zu2b_
   complexed with gol, peg
   has additional subdomain(s) that are not in the common domain

Details for d3tlob_

PDB Entry: 3tlo, 1.6 Å

PDB Description: Crystal structure of HCoV-NL63 3C-like protease

PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d3tlob_:

Sequence; same for both SEQRES and ATOM records:

>d3tlob_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus [TaxId: 443239]}
sglkkmaqpsgcvercvvrvcygstvlngvwlgdtvtcprhviapsttvlidydhaystm
rlhnfsvshngvflgvvgvtmhgsvlrikvsqsnvhtpkhvfktlkpgdsfnilacyegi
asgvfgvnlrtnftikgsfingacgspgynvrndgtvefcylhqielgsgahvgsdftgs
vygnfddqpslqvesanlmlsdnvvaflyaallngcrwwlcstrvnvdgfnewamangyt
svssvecysilaaktgvsveqllasiqhlhegfggknilgysslcdeftlaevvkqmygv
nl

Timeline for d3tlob_:

• d3tlob_ first appeared in SCOPe 2.02
  
• d3tlob_ appears in SCOPe 2.07