Lineage for d1derl1 (1der L:2-136,L:410-526)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217889Fold a.129: GroEL equatorial domain-like chaperone equatorial domain [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 217890Superfamily a.129.1: GroEL equatorial domain-like chaperone equatorial domain [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudodyad passing through the ATP-binding site
  5. 217891Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 217892Protein GroEL, E domain [48594] (2 species)
  7. 217893Species Escherichia coli [TaxId:562] [48595] (4 PDB entries)
  8. 217912Domain d1derl1: 1der L:2-136,L:410-526 [19470]
    Other proteins in same PDB: d1dera2, d1dera3, d1derb2, d1derb3, d1derc2, d1derc3, d1derd2, d1derd3, d1dere2, d1dere3, d1derf2, d1derf3, d1derg2, d1derg3, d1derh2, d1derh3, d1deri2, d1deri3, d1derj2, d1derj3, d1derk2, d1derk3, d1derl2, d1derl3, d1derm2, d1derm3, d1dern2, d1dern3

Details for d1derl1

PDB Entry: 1der (more details), 2.4 Å

PDB Description: the 2.4 angstrom crystal structure of the bacterial chaperonin groel complexed with atp-gamma-s

SCOP Domain Sequences for d1derl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1derl1 a.129.1.1 (L:2-136,L:410-526) GroEL, E domain {Escherichia coli}
aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtvaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlpk

SCOP Domain Coordinates for d1derl1:

Click to download the PDB-style file with coordinates for d1derl1.
(The format of our PDB-style files is described here.)

Timeline for d1derl1: