SCOPe 2.04: Domain d3vkob_: 3vko B:

Lineage for d3vkob_ (3vko B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (38 PDB entries)

8. Domain d3vkob_: 3vko B: [194696]
   automated match to d3ap5a_
   complexed with cl

Details for d3vkob_

PDB Entry: 3vko, 2.08 Å

PDB Description: galectin-8 n-terminal domain in complex with sialyllactosamine

PDB Compounds: (B:) Galectin-8

SCOPe Domain Sequences for d3vkob_:

Sequence; same for both SEQRES and ATOM records:

>d3vkob_ b.29.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradvafhf
nprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtlly
ghrigpekidtlgiygkvnihsigfsf

Timeline for d3vkob_:

• d3vkob_ first appeared in SCOPe 2.02
  
• d3vkob_ appears in SCOPe 2.03
  
• d3vkob_ appears in SCOPe 2.05
  
• d3vkob_ appears in the current release, SCOPe 2.08