Class a: All alpha proteins [46456] (290 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (3 families) Heme-containing proteins |
Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins) automatically mapped to Pfam PF01322 |
Protein automated matches [190363] (5 species) not a true protein |
Species Thermochromatium tepidum [TaxId:1050] [194692] (1 PDB entry) |
Domain d3vrcb_: 3vrc B: [194693] automated match to d1bbha_ complexed with cd, cl, hec, peg, pg4 |
PDB Entry: 3vrc (more details), 1 Å
SCOPe Domain Sequences for d3vrcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vrcb_ a.24.3.2 (B:) automated matches {Thermochromatium tepidum [TaxId: 1050]} adlspeeqietrqagyafmawnmgkikanlegeynadqvraaanvvaaiansgmgalygp gtdknvgavktrakpelfqnledvgklardlgtaanalaaaaatgeanavksafadvgaa ckachqkyrad
Timeline for d3vrcb_: