Lineage for d4fvka_ (4fvk A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2808129Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2808130Protein automated matches [190692] (20 species)
    not a true protein
  7. 2808214Species Influenza A virus, different strains [TaxId:11320] [188445] (32 PDB entries)
  8. 2808243Domain d4fvka_: 4fvk A: [194690]
    automated match to d3b7ea_
    complexed with ca, nag, zn

Details for d4fvka_

PDB Entry: 4fvk (more details), 2.2 Å

PDB Description: structural and functional characterization of neuraminidase-like molecule n10 derived from bat influenza a virus
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d4fvka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fvka_ b.68.1.0 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
fywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanq
hllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfim
ikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqr
wkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdf
prgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtv
slsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspv
qninwds

SCOPe Domain Coordinates for d4fvka_:

Click to download the PDB-style file with coordinates for d4fvka_.
(The format of our PDB-style files is described here.)

Timeline for d4fvka_: