Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein ADP-ribosylation factor [52614] (15 species) |
Species Mouse (Mus musculus), ARL3 [TaxId:10090] [52618] (3 PDB entries) |
Domain d4goja_: 4goj A: [194686] automated match to d1fzqa_ complexed with gnp, mg |
PDB Entry: 4goj (more details), 2.1 Å
SCOPe Domain Sequences for d4goja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4goja_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} llsilrklksapdqevrilllgldnagkttllkqlasedishitptqgfniksvqsqgfk lnvwdiggqrkirpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvl ifankqdlltaapaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknv
Timeline for d4goja_: