Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
Protein automated matches [190399] (4 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [187269] (4 PDB entries) |
Domain d3vk3a_: 3vk3 A: [194675] automated match to d1ukja_ complexed with met; mutant |
PDB Entry: 3vk3 (more details), 2.1 Å
SCOPe Domain Sequences for d3vk3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vk3a_ c.67.1.3 (A:) automated matches {Pseudomonas putida [TaxId: 303]} hgsnklpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfysr isnptlnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlyghtfafl hhgigefgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhga tvvvdntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglkd mtgavlsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqyt larqqmsqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssytp eerahygiseglvrlsvglediddlladvqqalkasa
Timeline for d3vk3a_: