Lineage for d3zz3b1 (3zz3 B:1-180)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797935Protein automated matches [190384] (21 species)
    not a true protein
  7. 2797984Species Human coxsackievirus [TaxId:12072] [188739] (11 PDB entries)
  8. 2797990Domain d3zz3b1: 3zz3 B:1-180 [194660]
    Other proteins in same PDB: d3zz3a2, d3zz3b2
    automated match to d2vb0a_
    mutant

Details for d3zz3b1

PDB Entry: 3zz3 (more details), 1.89 Å

PDB Description: crystal structure of 3c protease mutant (n126y) of coxsackievirus b3
PDB Compounds: (B:) 3C proteinase

SCOPe Domain Sequences for d3zz3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zz3b1 b.47.1.4 (B:1-180) automated matches {Human coxsackievirus [TaxId: 12072]}
gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak
elvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt
eygflylggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyfn

SCOPe Domain Coordinates for d3zz3b1:

Click to download the PDB-style file with coordinates for d3zz3b1.
(The format of our PDB-style files is described here.)

Timeline for d3zz3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zz3b2