SCOPe 2.05: Domain d4ffsa_: 4ffs A:

Lineage for d4ffsa_ (4ffs A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (36 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85963] [189517] (11 PDB entries)

8. Domain d4ffsa_: 4ffs A: [194638]
   automated match to d3nm6b_
   complexed with big, cl

Details for d4ffsa_

PDB Entry: 4ffs, 1.9 Å

PDB Description: Crystal structure of 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from Helicobacter pylori with butyl-thio-DADMe-Immucillin-A

PDB Compounds: (A:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d4ffsa_:

Sequence; same for both SEQRES and ATOM records:

>d4ffsa_ c.56.2.0 (A:) automated matches {Helicobacter pylori [TaxId: 85963]}
efmqkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhst
ltttsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesa
ifietsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegas
vafvcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel

Timeline for d4ffsa_:

• d4ffsa_ first appeared in SCOPe 2.02
  
• d4ffsa_ appears in SCOPe 2.04
  
• d4ffsa_ is called d4ffsa1 in SCOPe 2.06
  
• d4ffsa_ appears in the current release, SCOPe 2.08, called d4ffsa1