SCOPe 2.02: Domain d4gb33_: 4gb3 3:

Lineage for d4gb33_ (4gb3 3:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Human enterovirus B coat proteins [88635] (4 species)

7. Species Human coxsackievirus B3 [TaxId:12072] [49681] (2 PDB entries)

8. Domain d4gb33_: 4gb3 3: [194629]
   Other proteins in same PDB: d4gb31_
   automated match to d1cov3_
   complexed with myr, plm

Details for d4gb33_

PDB Entry: 4gb3, 2.74 Å

PDB Description: Human coxsackievirus B3 strain RD coat protein

PDB Compounds: (3:) coat protein 3

SCOPe Domain Sequences for d4gb33_:

Sequence; same for both SEQRES and ATOM records:

>d4gb33_ b.121.4.1 (3:) Human enterovirus B coat proteins {Human coxsackievirus B3 [TaxId: 12072]}
glptmntpgscqfltsddfqspsampqydvtpemripgevknlmeiaevdsvvpvqnvge
kvnsmeayqipvrsnegsgtqvfgfplqpgyssvfsrtllgeilnyythwsgsikltfmf
cgsamatgkfllaysppgagaptkrvdamlgthvvwdvglqsscvlcipwisqthyryva
sdeytaggfitcwyqtnivvpadaqsscyimcfvsacndfsvrllkdtpfitqqnffq

Timeline for d4gb33_:

• d4gb33_ is new in SCOPe 2.02-stable
  
• d4gb33_ appears in SCOPe 2.03
  
• d4gb33_ appears in the current release, SCOPe 2.08