SCOPe 2.02: Domain d4evgc_: 4evg C:

Lineage for d4evgc_ (4evg C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.3: MIF-related [55339] (3 proteins)

6. Protein Microphage migration inhibition factor (MIF) [55340] (6 species)
   synonym: glycosylation-inhibiting factor (GIF)

7. Species Human (Homo sapiens) [TaxId:9606] [55341] (31 PDB entries)

8. Domain d4evgc_: 4evg C: [194600]
   automated match to d3l5ua_
   complexed with so4; mutant

Details for d4evgc_

PDB Entry: 4evg, 1.7 Å

PDB Description: Crystal Structure of MIF L46A mutant

PDB Compounds: (C:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d4evgc_:

Sequence; same for both SEQRES and ATOM records:

>d4evgc_ d.80.1.3 (C:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqamafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

Timeline for d4evgc_:

• d4evgc_ is new in SCOPe 2.02-stable
  
• d4evgc_ appears in SCOPe 2.03
  
• d4evgc_ appears in the current release, SCOPe 2.08