Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein Old yellow enzyme (OYE) [51401] (2 species) |
Species Lager yeast (Saccharomyces pastorianus) [TaxId:27292] [51402] (20 PDB entries) |
Domain d4gxma_: 4gxm A: [194593] automated match to d1k03a_ complexed with 0wv, 1pe, cl, fmn, mg, na; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 4gxm (more details), 1.36 Å
SCOPe Domain Sequences for d4gxma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gxma_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqllvlgw aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns iaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl ekglplnkydrdtfyqmsahgyidyptyeealklgwdkk
Timeline for d4gxma_: