Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein Angiogenin [54094] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54095] (45 PDB entries) |
Domain d4ahma_: 4ahm A: [194569] automated match to d1a4yb_ complexed with tla; mutant |
PDB Entry: 4ahm (more details), 1.96 Å
SCOPe Domain Sequences for d4ahma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ahma_ d.5.1.1 (A:) Angiogenin {Human (Homo sapiens) [TaxId: 9606]} nsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenkng nphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpihldqsifrr
Timeline for d4ahma_: