SCOPe 2.02: Domain d4ekfa_: 4ekf A:

Lineage for d4ekfa_ (4ekf A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Human adenovirus 2 proteinase, adenain [54055] (1 species)

7. Species Mastadenovirus H2 [TaxId:10515] [54056] (3 PDB entries)

8. Domain d4ekfa_: 4ekf A: [194563]
   automated match to d1avpa_
   complexed with na

Details for d4ekfa_

PDB Entry: 4ekf, 0.98 Å

PDB Description: structure of the inactive adenovirus proteinase at 0.98 angstrom resolution

PDB Compounds: (A:) Adenain

SCOPe Domain Sequences for d4ekfa_:

Sequence, based on SEQRES records:

>d4ekfa_ d.3.1.7 (A:) Human adenovirus 2 proteinase, adenain {Mastadenovirus H2 [TaxId: 10515]}
mgsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntagretggvhwmafaw
nprsktcylfepfgfsdqrlkqvyqfeyesllrrsaiasspdrcitlekstqsvqgpnsa
acglfccmflhafanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysfler
hspyfrshsaqirsatsfchlknm

Sequence, based on observed residues (ATOM records):

>d4ekfa_ d.3.1.7 (A:) Human adenovirus 2 proteinase, adenain {Mastadenovirus H2 [TaxId: 10515]}
mgsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntaggvhwmafawnprs
ktcylfepfgfsdqrlkqvyqfeyesllrrsaitlekstqsvqgpnsaacglfccmflha
fanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysflerhspyfrshsaqi
rsatsfchlknm

Timeline for d4ekfa_:

• d4ekfa_ is new in SCOPe 2.02-stable
  
• d4ekfa_ appears in SCOPe 2.03
  
• d4ekfa_ appears in the current release, SCOPe 2.08