Lineage for d4fsle_ (4fsl E:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1130027Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1130028Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1131149Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1131206Protein beta-secretase (memapsin) [50671] (1 species)
  7. 1131207Species Human (Homo sapiens) [TaxId:9606] [50672] (139 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 1131405Domain d4fsle_: 4fsl E: [194560]
    automated match to d3kmxa_
    complexed with 0vb, iod

Details for d4fsle_

PDB Entry: 4fsl (more details), 2.5 Å

PDB Description: crystal structure of beta-site app-cleaving enzyme 1 (bace-db-mut) complex with n-(n-(4- acetamido-3-chloro-5-methylbenzyl) carbamimidoyl)-3-(4- methoxyphenyl)-5-methyl-4-isothiazolecarboxamide
PDB Compounds: (E:) Beta-secretase 1

SCOPe Domain Sequences for d4fsle_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fsle_ b.50.1.2 (E:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiigg
idhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpk
kvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfri
tilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsa
chvhdefrtaavegpfvtldmedcgyn

SCOPe Domain Coordinates for d4fsle_:

Click to download the PDB-style file with coordinates for d4fsle_.
(The format of our PDB-style files is described here.)

Timeline for d4fsle_: