Lineage for d1oelc5 (1oel C:2-136,C:410-525)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749675Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 1749676Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 1749677Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 1749678Protein GroEL, E domain [48594] (4 species)
  7. 1749679Species Escherichia coli [TaxId:562] [48595] (11 PDB entries)
  8. 1749710Domain d1oelc5: 1oel C:2-136,C:410-525 [19454]
    Other proteins in same PDB: d1oela2, d1oela3, d1oelb2, d1oelb3, d1oelc3, d1oelc4, d1oeld2, d1oeld3, d1oele2, d1oele3, d1oelf2, d1oelf3, d1oelg2, d1oelg3

Details for d1oelc5

PDB Entry: 1oel (more details), 2.8 Å

PDB Description: conformational variability in the refined structure of the chaperonin groel at 2.8 angstrom resolution
PDB Compounds: (C:) groEL (hsp60 class)

SCOPe Domain Sequences for d1oelc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oelc5 a.129.1.1 (C:2-136,C:410-525) GroEL, E domain {Escherichia coli [TaxId: 562]}
aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtvaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

SCOPe Domain Coordinates for d1oelc5:

Click to download the PDB-style file with coordinates for d1oelc5.
(The format of our PDB-style files is described here.)

Timeline for d1oelc5: