SCOPe 2.08: Domain d3tvdb_: 3tvd B:

Lineage for d3tvdb_ (3tvd B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [194536] (6 PDB entries)

8. Domain d3tvdb_: 3tvd B: [194537]
   automated match to d1cc0a_
   complexed with gsp, mg

Details for d3tvdb_

PDB Entry: 3tvd, 2.99 Å

PDB Description: Crystal Structure of Mouse RhoA-GTP complex

PDB Compounds: (B:) transforming protein rhoa

SCOPe Domain Sequences for d3tvdb_:

Sequence; same for both SEQRES and ATOM records:

>d3tvdb_ c.37.1.8 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdta
gqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdl
rndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa

Timeline for d3tvdb_:

• d3tvdb_ first appeared in SCOPe 2.02
  
• d3tvdb_ appears in SCOPe 2.07