SCOPe 2.07: Domain d3vhta_: 3vht A:

Lineage for d3vhta_ (3vht A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (5 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (272 PDB entries)
   Uniprot P42212

8. Domain d3vhta_: 3vht A: [194533]
   Other proteins in same PDB: d3vhtc_
   automated match to d3ogoc_
   complexed with zn

Details for d3vhta_

PDB Entry: 3vht, 2.4 Å

PDB Description: crystal structure of gfp-wrnip1 ubz domain fusion protein in complex with ubiquitin

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d3vhta_:

Sequence; same for both SEQRES and ATOM records:

>d3vhta_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
vttfgygvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlv
nrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqlad
hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagitg

Timeline for d3vhta_:

• d3vhta_ first appeared in SCOPe 2.02
  
• d3vhta_ appears in SCOPe 2.06
  
• d3vhta_ appears in the current release, SCOPe 2.08, called d3vhta1