SCOPe 2.02: Domain d4haab_: 4haa B:

Lineage for d4haab_ (4haa B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein automated matches [190834] (2 species)
   not a true protein

7. Species Bacillus intermedius [TaxId:1400] [194484] (1 PDB entry)

8. Domain d4haab_: 4haa B: [194485]
   automated match to d1buja_
   mutant

Details for d4haab_

PDB Entry: 4haa, 1.9 Å

PDB Description: Structure of Ribonuclease Binase Glu43Ala/Phe81Ala Mutant

PDB Compounds: (B:) Ribonuclease

SCOPe Domain Sequences for d4haab_:

Sequence; same for both SEQRES and ATOM records:

>d4haab_ d.1.1.2 (B:) automated matches {Bacillus intermedius [TaxId: 1400]}
avintfdgvadylirykrlpdnyitksqasalgwvaskgnlaavapgksiggdvfsnreg
rlpsasgrtwreadinyvsgarnadrlvyssdwliykttdhyatftrir

Timeline for d4haab_:

• d4haab_ is new in SCOPe 2.02-stable
  
• d4haab_ appears in SCOPe 2.03
  
• d4haab_ appears in the current release, SCOPe 2.08