SCOPe 2.02: Domain d4hg9b_: 4hg9 B:

Lineage for d4hg9b_ (4hg9 B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)

6. Protein automated matches [190139] (25 species)
   not a true protein

7. Species Gloydius halys [TaxId:8714] [194477] (1 PDB entry)

8. Domain d4hg9b_: 4hg9 B: [194479]
   automated match to d1jiaa_
   complexed with ca, cit, g3p, gol

Details for d4hg9b_

PDB Entry: 4hg9, 1.6 Å

PDB Description: Crystal structure of AhV_bPA, a basic PLA2 from Agkistrodon halys pallas venom

PDB Compounds: (B:) Basic phospholipase A2 B

SCOPe Domain Sequences for d4hg9b_:

Sequence; same for both SEQRES and ATOM records:

>d4hg9b_ a.133.1.2 (B:) automated matches {Gloydius halys [TaxId: 8714]}
hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
wddytyswkdgdivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
kc

Timeline for d4hg9b_:

• d4hg9b_ is new in SCOPe 2.02-stable
  
• d4hg9b_ appears in SCOPe 2.03
  
• d4hg9b_ appears in the current release, SCOPe 2.08