SCOPe 2.02: Domain d3u55a_: 3u55 A:

Lineage for d3u55a_ (3u55 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.143.1: SAICAR synthase-like [56104] (4 families)
   shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies

5. Family d.143.1.0: automated matches [191445] (1 protein)
   not a true family

6. Protein automated matches [190664] (5 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [194472] (1 PDB entry)

8. Domain d3u55a_: 3u55 A: [194473]
   automated match to d3nuab_
   complexed with act, so4

Details for d3u55a_

PDB Entry: 3u55, 1.9 Å

PDB Description: Crystal structure (Type-2) of SAICAR synthetase from Pyrococcus horikoshii OT3

PDB Compounds: (A:) phosphoribosylaminoimidazole-succinocarboxamide synthase

SCOPe Domain Sequences for d3u55a_:

Sequence; same for both SEQRES and ATOM records:

>d3u55a_ d.143.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
akkmipidddklimefkddatafdgtkkarfkgkgwlnaqlsviffklleehgikthfig
vaggnrlivekldmyplevvvrnvvagslkkrlplpegyelpepivelyykndelhdpmi
nyyhakvlgisldeikkieeialkvneilkdylakkgiilvdfklefgkdkngdivlade
ispdtcrfwdaktkrsldkdvfrfdkgdlieaykeiyeritgekpef

Timeline for d3u55a_:

• d3u55a_ is new in SCOPe 2.02-stable
  
• d3u55a_ appears in SCOPe 2.03
  
• d3u55a_ appears in the current release, SCOPe 2.08