Lineage for d4gtpb_ (4gtp B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1094085Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1094405Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 1094530Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 1094531Protein Protein farnesyltransferase, beta-subunit [48247] (3 species)
  7. 1094532Species Human (Homo sapiens) [TaxId:9606] [69090] (20 PDB entries)
    Uniprot P49356
  8. 1094545Domain d4gtpb_: 4gtp B: [194456]
    automated match to d1tn6b_
    complexed with 7tp, dms, fpp, zn

Details for d4gtpb_

PDB Entry: 4gtp (more details), 2.75 Å

PDB Description: FTase in complex with BMS analogue 16
PDB Compounds: (B:) Protein farnesyltransferase subunit beta

SCOPe Domain Sequences for d4gtpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gtpb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
eplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfh
ylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggf
gggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevd
vrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalv
ilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgd
palsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsga
mlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

SCOPe Domain Coordinates for d4gtpb_:

Click to download the PDB-style file with coordinates for d4gtpb_.
(The format of our PDB-style files is described here.)

Timeline for d4gtpb_: