SCOPe 2.02: Domain d4as8a_: 4as8 A:

Lineage for d4as8a_ (4as8 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (35 PDB entries)

8. Domain d4as8a_: 4as8 A: [194425]
   automated match to d3st2a_
   complexed with edo, mg

Details for d4as8a_

PDB Entry: 4as8, 1.02 Å

PDB Description: x-ray structure of the cyan fluorescent protein cerulean cryoprotected with ethylene glycol

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d4as8a_:

Sequence; same for both SEQRES and ATOM records:

>d4as8a_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
mvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
lvttltwgvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtl
vnrielkgidfkedgnilghkleynaisdnvyitadkqkngikanfkirhniedgsvqla
dhyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

Timeline for d4as8a_:

• d4as8a_ is new in SCOPe 2.02-stable
  
• d4as8a_ appears in SCOPe 2.03
  
• d4as8a_ appears in the current release, SCOPe 2.08, called d4as8a1