Lineage for d4dgia_ (4dgi A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1193177Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1193178Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1193179Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1193240Protein automated matches [191016] (1 species)
    not a true protein
  7. 1193241Species Human (Homo sapiens) [TaxId:9606] [188783] (4 PDB entries)
  8. 1193244Domain d4dgia_: 4dgi A: [194422]
    automated match to d1h0la_
    complexed with na

Details for d4dgia_

PDB Entry: 4dgi (more details), 2.4 Å

PDB Description: Structure of POM1 FAB fragment complexed with human PrPc Fragment 120-230
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d4dgia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dgia_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvnitik
qhtvttttkgenftetdvkmmervveqmcitqyeres

SCOPe Domain Coordinates for d4dgia_:

Click to download the PDB-style file with coordinates for d4dgia_.
(The format of our PDB-style files is described here.)

Timeline for d4dgia_: