Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
Superfamily d.6.1: Prion-like [54098] (1 family) |
Family d.6.1.1: Prion-like [54099] (3 proteins) |
Protein automated matches [191016] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188783] (4 PDB entries) |
Domain d4dgia_: 4dgi A: [194422] automated match to d1h0la_ complexed with na |
PDB Entry: 4dgi (more details), 2.4 Å
SCOPe Domain Sequences for d4dgia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dgia_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvnitik qhtvttttkgenftetdvkmmervveqmcitqyeres
Timeline for d4dgia_: