SCOPe 2.02: Domain d4gvqc_: 4gvq C:

Lineage for d4gvqc_ (4gvq C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.147: Methenyltetrahydromethanopterin cyclohydrolase [56198] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.147.1: Methenyltetrahydromethanopterin cyclohydrolase [56199] (2 families)

5. Family d.147.1.0: automated matches [194406] (1 protein)
   not a true family

6. Protein automated matches [194407] (1 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:224325] [194408] (2 PDB entries)

8. Domain d4gvqc_: 4gvq C: [194411]
   automated match to d1qlma_
   complexed with n4m

Details for d4gvqc_

PDB Entry: 4gvq, 1.3 Å

PDB Description: X-ray structure of the Archaeoglobus fulgidus methenyl-tetrahydromethanopterin cyclohydrolase in complex with tetrahydromethanpterin

PDB Compounds: (C:) methenyltetrahydromethanopterin cyclohydrolase

SCOPe Domain Sequences for d4gvqc_:

Sequence; same for both SEQRES and ATOM records:

>d4gvqc_ d.147.1.0 (C:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mlsvneiaaeivedmldyeeelrieskklengaivvdcgvnvpgsydagimytqvcmggl
advdivvdtindvpfafvteytdhpaiaclgsqkagwqikvdkyfamgsgparalalkpk
ktyerieyeddadvavialeanqlpdekvmefiakecdvdpenvyalvaptasivgsvqi
sgrivetaifkmneigydpklivsgagrcpispilendlkamgstndsmmyygsvfltvk
kydeilknvpsctsrdygkpfyeifkaanydfykidpnlfapaqiavndletgktyvhgk
lnaevlfqsyqivle

Timeline for d4gvqc_:

• d4gvqc_ is new in SCOPe 2.02-stable
  
• d4gvqc_ appears in SCOPe 2.03
  
• d4gvqc_ appears in the current release, SCOPe 2.08