SCOPe 2.07: Domain d4g9sa1: 4g9s A:7-185

Lineage for d4g9sa1 (4g9s A:7-185)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.5: G-type lysozyme [53987] (2 proteins)

6. Protein automated matches [191098] (3 species)
   not a true protein

7. Species Atlantic salmon (Salmo salar) [TaxId:8030] [189321] (2 PDB entries)

8. Domain d4g9sa1: 4g9s A:7-185 [194362]
   Other proteins in same PDB: d4g9sa2
   automated match to d3mgwa_
   complexed with cl, flc

Details for d4g9sa1

PDB Entry: 4g9s, 0.95 Å

PDB Description: Crystal structure of Escherichia coli PliG in complex with Atlantic salmon g-type lysozyme

PDB Compounds: (A:) Goose-type lysozyme

SCOPe Domain Sequences for d4g9sa1:

Sequence; same for both SEQRES and ATOM records:

>d4g9sa1 d.2.1.5 (A:7-185) automated matches {Atlantic salmon (Salmo salar) [TaxId: 8030]}
ditkvdtsgaseitarqdkltlqgvdashklaehdlvrmnkykelitrvgqkhgldpaii
agiisresragsaldhgwgdhgkgfglmqvdkryhkivgawdsekhisqgteiliefirr
iqakfpvwpkehqlkggisaynagdknvrtyermdvgttggdysndvvarsqwfksqgy

Timeline for d4g9sa1:

• d4g9sa1 first appeared in SCOPe 2.02, called d4g9sa_
  
• d4g9sa1 appears in SCOPe 2.06
  
• d4g9sa1 appears in the current release, SCOPe 2.08