Lineage for d4g9sa_ (4g9s A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1190374Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1190375Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1191688Family d.2.1.5: G-type lysozyme [53987] (2 proteins)
  6. 1191696Protein automated matches [191098] (2 species)
    not a true protein
  7. 1191706Species Atlantic salmon (Salmo salar) [TaxId:8030] [189321] (2 PDB entries)
  8. 1191707Domain d4g9sa_: 4g9s A: [194362]
    automated match to d3mgwa_
    complexed with cl, flc

Details for d4g9sa_

PDB Entry: 4g9s (more details), 0.95 Å

PDB Description: Crystal structure of Escherichia coli PliG in complex with Atlantic salmon g-type lysozyme
PDB Compounds: (A:) Goose-type lysozyme

SCOPe Domain Sequences for d4g9sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g9sa_ d.2.1.5 (A:) automated matches {Atlantic salmon (Salmo salar) [TaxId: 8030]}
hhhhhhhmditkvdtsgaseitarqdkltlqgvdashklaehdlvrmnkykelitrvgqk
hgldpaiiagiisresragsaldhgwgdhgkgfglmqvdkryhkivgawdsekhisqgte
iliefirriqakfpvwpkehqlkggisaynagdknvrtyermdvgttggdysndvvarsq
wfksqgy

SCOPe Domain Coordinates for d4g9sa_:

Click to download the PDB-style file with coordinates for d4g9sa_.
(The format of our PDB-style files is described here.)

Timeline for d4g9sa_: