SCOPe 2.05: Domain d4gs7d_: 4gs7 D:

Lineage for d4gs7d_ (4gs7 D:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Interleukin-15 receptor subunit alpha [161139] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161141] (4 PDB entries)
   Uniprot Q13261 31-108! Uniprot Q13261 31-96

8. Domain d4gs7d_: 4gs7 D: [194359]
   Other proteins in same PDB: d4gs7a_, d4gs7b1, d4gs7b2, d4gs7c1, d4gs7c2
   automated match to d2z3qd1
   complexed with act, edo, nag

Details for d4gs7d_

PDB Entry: 4gs7, 2.35 Å

PDB Description: structure of the interleukin-15 quaternary complex

PDB Compounds: (D:) Interleukin-15 receptor subunit alpha

SCOPe Domain Sequences for d4gs7d_:

Sequence; same for both SEQRES and ATOM records:

>d4gs7d_ g.18.1.1 (D:) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]}
itcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttps
lkcirdp

Timeline for d4gs7d_:

• d4gs7d_ first appeared in SCOPe 2.02
  
• d4gs7d_ appears in SCOPe 2.04
  
• d4gs7d_ appears in SCOPe 2.06
  
• d4gs7d_ appears in the current release, SCOPe 2.08