Class g: Small proteins [56992] (92 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein Interleukin-15 receptor subunit alpha [161139] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [161141] (4 PDB entries) Uniprot Q13261 31-108! Uniprot Q13261 31-96 |
Domain d4gs7d_: 4gs7 D: [194359] Other proteins in same PDB: d4gs7a_, d4gs7b1, d4gs7b2, d4gs7c1, d4gs7c2 automated match to d2z3qd1 complexed with act, edo, nag |
PDB Entry: 4gs7 (more details), 2.35 Å
SCOPe Domain Sequences for d4gs7d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gs7d_ g.18.1.1 (D:) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} itcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttps lkcirdp
Timeline for d4gs7d_: