Lineage for d4gs7d_ (4gs7 D:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462047Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 1462048Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 1462049Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
    Pfam PF00084
  6. 1462264Protein Interleukin-15 receptor subunit alpha [161139] (2 species)
  7. 1462265Species Human (Homo sapiens) [TaxId:9606] [161141] (4 PDB entries)
    Uniprot Q13261 31-108! Uniprot Q13261 31-96
  8. 1462276Domain d4gs7d_: 4gs7 D: [194359]
    Other proteins in same PDB: d4gs7a_, d4gs7b1, d4gs7b2, d4gs7c1, d4gs7c2
    automated match to d2z3qd1
    complexed with act, edo, nag

Details for d4gs7d_

PDB Entry: 4gs7 (more details), 2.35 Å

PDB Description: structure of the interleukin-15 quaternary complex
PDB Compounds: (D:) Interleukin-15 receptor subunit alpha

SCOPe Domain Sequences for d4gs7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gs7d_ g.18.1.1 (D:) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]}
itcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttps
lkcirdp

SCOPe Domain Coordinates for d4gs7d_:

Click to download the PDB-style file with coordinates for d4gs7d_.
(The format of our PDB-style files is described here.)

Timeline for d4gs7d_: