SCOPe 2.06: Domain d4hp8b_: 4hp8 B:

Lineage for d4hp8b_ (4hp8 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [194353] (2 PDB entries)

8. Domain d4hp8b_: 4hp8 B: [194355]
   automated match to d3uf0a_
   complexed with act, nap

Details for d4hp8b_

PDB Entry: 4hp8, 1.35 Å

PDB Description: Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from Agrobacterium Tumefaciens (target EFI-506435) with bound NADP

PDB Compounds: (B:) 2-deoxy-D-gluconate 3-dehydrogenase

SCOPe Domain Sequences for d4hp8b_:

Sequence; same for both SEQRES and ATOM records:

>d4hp8b_ c.2.1.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
knpfslegrkalvtgantglgqaiavglaaagaevvcaarrapdetldiiakdggnasal
lidfadplaakdsftdagfdilvnnagiirradsvefseldwdevmdvnlkalffttqaf
akellakgrsgkvvniasllsfqggirvpsytaakhgvagltkllanewaakginvnaia
pgyietnntealradaarnkaileripagrwghsediagaavflssaaadyvhgailnvd
ggwlar

Timeline for d4hp8b_:

• d4hp8b_ first appeared in SCOPe 2.02
  
• d4hp8b_ appears in SCOPe 2.05
  
• d4hp8b_ appears in SCOPe 2.07
  
• d4hp8b_ appears in the current release, SCOPe 2.08