Lineage for d4hp8a_ (4hp8 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1153904Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1153905Protein automated matches [190069] (73 species)
    not a true protein
  7. 1153912Species Agrobacterium tumefaciens [TaxId:176299] [194353] (2 PDB entries)
  8. 1153913Domain d4hp8a_: 4hp8 A: [194354]
    automated match to d3uf0a_
    complexed with act, nap

Details for d4hp8a_

PDB Entry: 4hp8 (more details), 1.35 Å

PDB Description: Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from Agrobacterium Tumefaciens (target EFI-506435) with bound NADP
PDB Compounds: (A:) 2-deoxy-D-gluconate 3-dehydrogenase

SCOPe Domain Sequences for d4hp8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hp8a_ c.2.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
npfslegrkalvtgantglgqaiavglaaagaevvcaarrapdetldiiakdggnasall
idfadplaakdsftdagfdilvnnagiirradsvefseldwdevmdvnlkalffttqafa
kellakgrsgkvvniasllsfqggirvpsytaakhgvagltkllanewaakginvnaiap
gyietnntealradaarnkaileripagrwghsediagaavflssaaadyvhgailnvdg
gwlar

SCOPe Domain Coordinates for d4hp8a_:

Click to download the PDB-style file with coordinates for d4hp8a_.
(The format of our PDB-style files is described here.)

Timeline for d4hp8a_: