SCOPe 2.06: Domain d3vrfb_: 3vrf B:

Lineage for d3vrfb_ (3vrf B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (42 species)
   not a true protein

7. Species Mammuthus primigenius [TaxId:37349] [194337] (3 PDB entries)

8. Domain d3vrfb_: 3vrf B: [194341]
   automated match to d2raob_
   complexed with cmo, hem

Details for d3vrfb_

PDB Entry: 3vrf, 1.55 Å

PDB Description: the crystal structure of hemoglobin from woolly mammoth in the carbonmonoxy forms

PDB Compounds: (B:) Hemoglobin subunit beta/delta hybrid

SCOPe Domain Sequences for d3vrfb_:

Sequence; same for both SEQRES and ATOM records:

>d3vrfb_ a.1.1.2 (B:) automated matches {Mammuthus primigenius [TaxId: 37349]}
vnltaaektqvanlwgkvnvkelggealsrllvvypwtrrffehfgdlstadavlhnakv
lahgekvltsfgeglkhldnlkgtfsdlselhcdklhvdpqnfrllgnvlvivlarhfgk
eftpdvqaayekvvagvanalahkyh

Timeline for d3vrfb_:

• d3vrfb_ first appeared in SCOPe 2.02
  
• d3vrfb_ appears in SCOPe 2.05
  
• d3vrfb_ appears in SCOPe 2.07
  
• d3vrfb_ appears in the current release, SCOPe 2.08