Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (64 species) not a true protein |
Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [194322] (1 PDB entry) |
Domain d4h0nc_: 4h0n C: [194324] automated match to d1g55a_ complexed with ca, sah; mutant |
PDB Entry: 4h0n (more details), 2.71 Å
SCOPe Domain Sequences for d4h0nc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h0nc_ c.66.1.0 (C:) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} shkilelysgiggmhcawkesgldgeivaavdintvansvykhnfpetnllnrniqqltp qvikkwnvdtilmsppcqpftrngkylddndprtnsflyligildqldnvdyilmenvkg fenstvrnlfidklkecnfiyqefllcpstvgvpnsrlryyctarrnnltwpfkrrdeii trlpkdfgvphslesiieedvdekflvpekmlrcakvfdicyktskrsccftkaythyad gtgsiftdkprevvqkcyaaaaqneiggekfvelfkelklryftpkevlmimcfpksynl ptnismkqcyrllgnsvnvkvisellkilfe
Timeline for d4h0nc_: