![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (23 species) not a true protein |
![]() | Species Spodoptera frugiperda [TaxId:7108] [194322] (1 PDB entry) |
![]() | Domain d4h0na_: 4h0n A: [194323] automated match to d1g55a_ complexed with ca, sah; mutant |
PDB Entry: 4h0n (more details), 2.71 Å
SCOPe Domain Sequences for d4h0na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h0na_ c.66.1.0 (A:) automated matches {Spodoptera frugiperda [TaxId: 7108]} shkilelysgiggmhcawkesgldgeivaavdintvansvykhnfpetnllnrniqqltp qvikkwnvdtilmsppcqpftrngkylddndprtnsflyligildqldnvdyilmenvkg fenstvrnlfidklkecnfiyqefllcpstvgvpnsrlryyctarrnnltwpfkrrdeii trlpkdfgvphslesiieedvdekflvpekmlrcakvfdicyktskrsccftkaythyad gtgsiftdkprevvqkcyaaaaqneiggekfvelfkelklryftpkevlmimcfpksynl ptnismkqcyrllgnsvnvkvisellkilfe
Timeline for d4h0na_: