Lineage for d4h0na_ (4h0n A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1175720Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1175721Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1176809Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1176810Protein automated matches [190689] (23 species)
    not a true protein
  7. 1176903Species Spodoptera frugiperda [TaxId:7108] [194322] (1 PDB entry)
  8. 1176904Domain d4h0na_: 4h0n A: [194323]
    automated match to d1g55a_
    complexed with ca, sah; mutant

Details for d4h0na_

PDB Entry: 4h0n (more details), 2.71 Å

PDB Description: crystal structure of spodoptera frugiperda dnmt2 e260a/e261a/k263a mutant
PDB Compounds: (A:) dnmt2

SCOPe Domain Sequences for d4h0na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h0na_ c.66.1.0 (A:) automated matches {Spodoptera frugiperda [TaxId: 7108]}
shkilelysgiggmhcawkesgldgeivaavdintvansvykhnfpetnllnrniqqltp
qvikkwnvdtilmsppcqpftrngkylddndprtnsflyligildqldnvdyilmenvkg
fenstvrnlfidklkecnfiyqefllcpstvgvpnsrlryyctarrnnltwpfkrrdeii
trlpkdfgvphslesiieedvdekflvpekmlrcakvfdicyktskrsccftkaythyad
gtgsiftdkprevvqkcyaaaaqneiggekfvelfkelklryftpkevlmimcfpksynl
ptnismkqcyrllgnsvnvkvisellkilfe

SCOPe Domain Coordinates for d4h0na_:

Click to download the PDB-style file with coordinates for d4h0na_.
(The format of our PDB-style files is described here.)

Timeline for d4h0na_: