Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
Protein automated matches [191100] (5 species) not a true protein |
Species Methanocaldococcus jannaschii [TaxId:243232] [194300] (1 PDB entry) |
Domain d2p9md_: 2p9m D: [194301] automated match to d3kpca_ |
PDB Entry: 2p9m (more details), 2.59 Å
SCOPe Domain Sequences for d2p9md_:
Sequence, based on SEQRES records: (download)
>d2p9md_ d.37.1.0 (D:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]} dtlknikvkdvmtknvitakrhegvveafekmlkykisslpviddenkvigivtttdigy nlirdkytlettigdvmtkdvitihedasileaikkmdisgkkeeiinqlpvvdknnklv giisdgdiirtiski
>d2p9md_ d.37.1.0 (D:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]} dtlknikvkdvmtknvitakrhegvveafekmlkykisslpviddenkvigivtttdigy nlirdkytlettigdvmtkdvitihedasileaikkmdiinqlpvvdknnklvgiisdgd iirtiski
Timeline for d2p9md_: