Lineage for d4hjka_ (4hjk A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402659Protein automated matches [190118] (8 species)
    not a true protein
  7. 1402675Species Human (Homo sapiens) [TaxId:9606] [189560] (36 PDB entries)
  8. 1402693Domain d4hjka_: 4hjk A: [194297]
    automated match to d3nheb_
    complexed with po4

Details for d4hjka_

PDB Entry: 4hjk (more details), 1.78 Å

PDB Description: U7Ub7 Disulfide variant
PDB Compounds: (A:) Ubiquitin

SCOPe Domain Sequences for d4hjka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hjka_ d.15.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amqifvkcltgktntlevepsdtienvkakiqdkigyppdqqrlifagkqledgrtlsdy
niqkestlhcvrrlrgg

SCOPe Domain Coordinates for d4hjka_:

Click to download the PDB-style file with coordinates for d4hjka_.
(The format of our PDB-style files is described here.)

Timeline for d4hjka_: