SCOPe 2.02: Domain d4hipb_: 4hip B:

Lineage for d4hipb_ (4hip B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (74 PDB entries)
   Uniprot P00282

8. Domain d4hipb_: 4hip B: [194296]
   automated match to d3iboa_
   complexed with cu

Details for d4hipb_

PDB Entry: 4hip, 1.9 Å

PDB Description: Crystal structure of the Pseudomonas aeruginosa azurin, H126NO YOH109

PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d4hipb_:

Sequence; same for both SEQRES and ATOM records:

>d4hipb_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnfvlstaadmqgvv
tdgmasgldkdflkpddsrviaqtkligsgekdsvtfdvsklkegeqfmffctfpghsal
mygtlhlk

Timeline for d4hipb_:

• d4hipb_ is new in SCOPe 2.02-stable
  
• d4hipb_ appears in SCOPe 2.03
  
• d4hipb_ appears in the current release, SCOPe 2.08