SCOPe 2.02: Domain d4hn0d_: 4hn0 D:

Lineage for d4hn0d_ (4hn0 D:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (7 species)
   not a true protein

7. Species Streptomyces bikiniensis [TaxId:1896] [193359] (3 PDB entries)

8. Domain d4hn0d_: 4hn0 D: [194293]
   automated match to d2c0za1
   complexed with cl, edo

Details for d4hn0d_

PDB Entry: 4hn0, 2.2 Å

PDB Description: Crystal Structure of ChmJ, a 3'-monoepimerase apoenzyme from Streptomyces bikiniensis

PDB Compounds: (D:) Putative 3-epimerase in D-allose pathway

SCOPe Domain Sequences for d4hn0d_:

Sequence; same for both SEQRES and ATOM records:

>d4hn0d_ b.82.1.0 (D:) automated matches {Streptomyces bikiniensis [TaxId: 1896]}
mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgih
yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
sltddatlvylcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
llptyqawqeqqqaqrl

Timeline for d4hn0d_:

• d4hn0d_ is new in SCOPe 2.02-stable
  
• d4hn0d_ appears in SCOPe 2.03
  
• d4hn0d_ appears in the current release, SCOPe 2.08, called d4hn0d1