Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins) |
Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species) |
Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (20 PDB entries) |
Domain d3unlb_: 3unl B: [194287] automated match to d1iska_ complexed with so4 |
PDB Entry: 3unl (more details), 2.52 Å
SCOPe Domain Sequences for d3unlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3unlb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} mntpehmtavvqryvaalnagdldgivalfaddatvedpvgseprsgtaairegyanslk lplaveltqevravaneaafaftvsfeyqgrktvvapidhfrfngagkvvsmralfgekn ihag
Timeline for d3unlb_: